DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9863 and Maip1

DIOPT Version :9

Sequence 1:NP_611780.3 Gene:CG9863 / 37694 FlyBaseID:FBgn0034846 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001074650.1 Gene:Maip1 / 68115 MGIID:1915365 Length:291 Species:Mus musculus


Alignment Length:64 Identity:18/64 - (28%)
Similarity:26/64 - (40%) Gaps:9/64 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SQPHRNVSLFTGRQPHWKLRVMQFLSGLRHRYCLWRLR---RLLGVAFDE----GGFHEGTRQA 86
            :.|.|:.|  |..||..:.|....:.|..:.....|.|   .|:...||:    ..|.||.:||
Mouse    90 ASPSRSYS--TEEQPQQRQRTRMIILGFSNPINWVRTRIYAFLIWAYFDKEFSIAEFSEGAKQA 151



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13333
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.