DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9863 and Maip1

DIOPT Version :10

Sequence 1:NP_611780.3 Gene:CG9863 / 37694 FlyBaseID:FBgn0034846 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001074650.1 Gene:Maip1 / 68115 MGIID:1915365 Length:291 Species:Mus musculus


Alignment Length:64 Identity:18/64 - (28%)
Similarity:26/64 - (40%) Gaps:9/64 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SQPHRNVSLFTGRQPHWKLRVMQFLSGLRHRYCLWRLR---RLLGVAFDE----GGFHEGTRQA 86
            :.|.|:.|  |..||..:.|....:.|..:.....|.|   .|:...||:    ..|.||.:||
Mouse    90 ASPSRSYS--TEEQPQQRQRTRMIILGFSNPINWVRTRIYAFLIWAYFDKEFSIAEFSEGAKQA 151

Return to query results.
Submit another query.