powered by:
Protein Alignment CG9863 and Maip1
DIOPT Version :9
Sequence 1: | NP_611780.3 |
Gene: | CG9863 / 37694 |
FlyBaseID: | FBgn0034846 |
Length: | 267 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001074650.1 |
Gene: | Maip1 / 68115 |
MGIID: | 1915365 |
Length: | 291 |
Species: | Mus musculus |
Alignment Length: | 64 |
Identity: | 18/64 - (28%) |
Similarity: | 26/64 - (40%) |
Gaps: | 9/64 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 SQPHRNVSLFTGRQPHWKLRVMQFLSGLRHRYCLWRLR---RLLGVAFDE----GGFHEGTRQA 86
:.|.|:.| |..||..:.|....:.|..:.....|.| .|:...||: ..|.||.:||
Mouse 90 ASPSRSYS--TEEQPQQRQRTRMIILGFSNPINWVRTRIYAFLIWAYFDKEFSIAEFSEGAKQA 151
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR13333 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.