DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9863 and maip1

DIOPT Version :9

Sequence 1:NP_611780.3 Gene:CG9863 / 37694 FlyBaseID:FBgn0034846 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001032303.1 Gene:maip1 / 552941 ZFINID:ZDB-GENE-050506-22 Length:243 Species:Danio rerio


Alignment Length:210 Identity:39/210 - (18%)
Similarity:64/210 - (30%) Gaps:64/210 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CNSNTSQSQPHRNVSLFTGRQPHWKLRVMQF-----LSGLRHRYCLWRLRRLLGVAFDEGGFHEG 82
            |:.....|:|.|.     .|.|    ||:.|     :...|:|...:.:|......|....|.||
Zfish    41 CDVRRYSSEPERR-----KRNP----RVVVFGIPNPIIWFRNRIYFFLIRAYFDKEFSIEEFMEG 96

  Fly    83 TRQA-----------------AVTMIDAVRQADWPCI-------RSCCTE--------RGSADIY 115
            ..||                 .:...|.:::.:..|.       |:...|        .|...||
Zfish    97 AIQAFSHVSRLLSQCQFEALEGLVAKDLIKKLEGKCAHLPLSHQRALSAEPDDIMYMTAGDVGIY 161

  Fly   116 GLSQMRSPYCSLVRFQKEHLRHALPVRVVRRWIDGRYYVMVDMLFVGLRNLLDLGTEQEKEEMLQ 180
            .....|.....|:||.     :....:.....:||.....|           .:|.|:||:...:
Zfish   162 YDDSERKFVSILMRFW-----YLTSAKFPDESVDGAKVFQV-----------AIGDEREKQTETK 210

  Fly   181 RIQSVLVNSQIDDKF 195
            |:  :..|.:...:|
Zfish   211 RL--LTANYEFQREF 223



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1056493at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13333
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.