DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R1 and Psma4

DIOPT Version :10

Sequence 1:NP_611776.1 Gene:Prosbeta5R1 / 37690 FlyBaseID:FBgn0034842 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_036096.1 Gene:Psma4 / 26441 MGIID:1347060 Length:261 Species:Mus musculus


Alignment Length:155 Identity:39/155 - (25%)
Similarity:65/155 - (41%) Gaps:13/155 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 HGTTTLGFKYRGGVILCADSRATSGQYIGSQTMRKIVELNDYMLGTLAGGAADCVYWDRVLAKEC 134
            |..|.||.....||:|.|:.|.............||.:||:.|..::||..:|.    .||..|.
Mouse    30 HAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDA----NVLTNEL 90

  Fly   135 RL----HQLRYRKRMTVDTAARIICNISTEYKGMG----LVMGMMLAGFDDE-GPKLIYVDSEGM 190
            ||    :.|:|::.:..:.....:|:|...|...|    ..:.::..|:|.. |.:|...|..|.
Mouse    91 RLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGN 155

  Fly   191 RSHGQVFSVGSGSPYALGVLDTGYR 215
            ....:...:|:.|..|:.:|...|:
Mouse   156 YGGWKATCIGNNSAAAVSMLKQDYK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R1NP_611776.1 proteasome_beta_type_5 72..259 CDD:239730 38/153 (25%)
Psma4NP_036096.1 proteasome_alpha_type_4 3..216 CDD:239721 39/155 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.