DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL22-like and RPL22A

DIOPT Version :9

Sequence 1:NP_611771.1 Gene:RpL22-like / 37684 FlyBaseID:FBgn0034837 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_013162.1 Gene:RPL22A / 850750 SGDID:S000004051 Length:121 Species:Saccharomyces cerevisiae


Alignment Length:125 Identity:40/125 - (32%)
Similarity:76/125 - (60%) Gaps:8/125 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 NVLRGKRLAKKKAWQRFVIDCACVAEDMILDLADFEQYLKTHIKIKNKLNQLKDQVTFERTKNFS 242
            |..|.:::||     .|.:|.:...|:.:.|.|.:.:||..|||::..:..|.:.||.  |::.:
Yeast     4 NTSRKQKIAK-----TFTVDVSSPTENGVFDPASYAKYLIDHIKVEGAVGNLGNAVTV--TEDGT 61

  Fly   243 LI-IHSGVHFSKRYFKYLTKRYLKKVSLRDWLRVVSTAKDTFAMTYFKIQDKDFDDDDDD 301
            :: :.|...||.:|.|||||:||||..||||:|.|||..:.:.:.::::..::.:::|::
Yeast    62 VVTVVSTAKFSGKYLKYLTKKYLKKNQLRDWIRFVSTKTNEYRLAFYQVTPEEDEEEDEE 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL22-likeNP_611771.1 Ribosomal_L22e 189..291 CDD:280028 35/102 (34%)
RPL22ANP_013162.1 Ribosomal_L22e 15..110 CDD:396370 35/96 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344091
Domainoid 1 1.000 99 1.000 Domainoid score I1574
eggNOG 1 0.900 - - E1_KOG3434
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S589
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001115
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101015
Panther 1 1.100 - - O PTHR10064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X685
TreeFam 1 0.960 - -
1110.650

Return to query results.
Submit another query.