DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL22-like and AT1G02830

DIOPT Version :9

Sequence 1:NP_611771.1 Gene:RpL22-like / 37684 FlyBaseID:FBgn0034837 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_171782.1 Gene:AT1G02830 / 838098 AraportID:AT1G02830 Length:127 Species:Arabidopsis thaliana


Alignment Length:117 Identity:50/117 - (42%)
Similarity:78/117 - (66%) Gaps:6/117 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 AKKKAWQRFVIDCACVAEDMILDLADFEQYLKTHIKIKNKLNQLKDQVTFERTKNFSLIIHSGVH 250
            ||||. ..|||||:...:|.||::|..|::|:..||::.|...|.:.|:..| .|..:.:::..:
plant    13 AKKKG-VSFVIDCSKPVDDTILEIATLEKFLQERIKVRGKAGALGNSVSITR-YNGKINVNANSN 75

  Fly   251 FSKRYFKYLTKRYLKKVSLRDWLRVVSTAKD--TFAMTYFKIQDK--DFDDD 298
            |||||.|||||:||||.:|||||||:::.||  .:.:.||:|.|:  .:::|
plant    76 FSKRYLKYLTKKYLKKYNLRDWLRVIASNKDKNVYEVRYFRIDDEVASYEED 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL22-likeNP_611771.1 Ribosomal_L22e 189..291 CDD:280028 44/103 (43%)
AT1G02830NP_171782.1 Ribosomal_L22e 20..119 CDD:396370 44/99 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3434
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1594080at2759
OrthoFinder 1 1.000 - - FOG0001115
OrthoInspector 1 1.000 - - mtm1124
orthoMCL 1 0.900 - - OOG6_101015
Panther 1 1.100 - - O PTHR10064
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X685
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.