DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL22-like and AT5G27770

DIOPT Version :9

Sequence 1:NP_611771.1 Gene:RpL22-like / 37684 FlyBaseID:FBgn0034837 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_198129.1 Gene:AT5G27770 / 832839 AraportID:AT5G27770 Length:124 Species:Arabidopsis thaliana


Alignment Length:123 Identity:49/123 - (39%)
Similarity:73/123 - (59%) Gaps:5/123 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 RGKRLAK--KKAWQRFVIDCACVAEDMILDLADFEQYLKTHIKIKNKLNQLKDQVTFERTKNFSL 243
            ||...|.  ||....|.|||:...:|.|:::|..|::|:..||:..|...|.|.|:..|.|:...
plant     3 RGNAAAAKGKKKGVSFTIDCSKPVDDKIMEIASLEKFLQERIKVGGKAGALGDSVSITREKSKIT 67

  Fly   244 IIHSGVHFSKRYFKYLTKRYLKKVSLRDWLRVVSTAKD--TFAMTYFKIQDKDFDDDD 299
            :...| .|||||.|||||:||||.::||||||::..||  .:.:.||.|.:.:.:::|
plant    68 VTADG-QFSKRYLKYLTKKYLKKHNVRDWLRVIAANKDRNLYELRYFNIAENEAEEED 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL22-likeNP_611771.1 Ribosomal_L22e 189..291 CDD:280028 43/103 (42%)
AT5G27770NP_198129.1 Ribosomal_L22e 18..113 CDD:396370 40/95 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3434
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1594080at2759
OrthoFinder 1 1.000 - - FOG0001115
OrthoInspector 1 1.000 - - mtm1124
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10064
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X685
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.