DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL22-like and Rpl22l2

DIOPT Version :9

Sequence 1:NP_611771.1 Gene:RpL22-like / 37684 FlyBaseID:FBgn0034837 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_038962010.1 Gene:Rpl22l2 / 680575 RGDID:1590585 Length:122 Species:Rattus norvegicus


Alignment Length:115 Identity:53/115 - (46%)
Similarity:74/115 - (64%) Gaps:3/115 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 KKKAWQRFVIDCACVAEDMILDLADFEQYLKTHIKIKNKLNQLKDQVTFERTKNFSLIIHSGVHF 251
            ||..| ||.:|.....||.|.|..:|||:|:..:|:..|...|.:.|..||.|| .:.:.|...|
  Rat    10 KKSTW-RFHLDLTHPVEDGIFDSGNFEQFLREKVKVNGKTGNLGNVVHIERLKN-KITVVSEKQF 72

  Fly   252 SKRYFKYLTKRYLKKVSLRDWLRVVSTAKDTFAMTYFKI-QDKDFDDDDD 300
            ||||.|:|||:||||.:||||||||::.|:|:.:.||:| ||:|..:.:|
  Rat    73 SKRYLKHLTKKYLKKNNLRDWLRVVASDKETYELRYFQISQDEDGSESED 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL22-likeNP_611771.1 Ribosomal_L22e 189..291 CDD:280028 47/102 (46%)
Rpl22l2XP_038962010.1 Ribosomal_L22e 16..113 CDD:396370 45/97 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001115
OrthoInspector 1 1.000 - - mtm9034
orthoMCL 1 0.900 - - OOG6_101015
Panther 1 1.100 - - O PTHR10064
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X685
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.