DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL22-like and RPL22

DIOPT Version :9

Sequence 1:NP_611771.1 Gene:RpL22-like / 37684 FlyBaseID:FBgn0034837 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_000974.1 Gene:RPL22 / 6146 HGNCID:10315 Length:128 Species:Homo sapiens


Alignment Length:126 Identity:59/126 - (46%)
Similarity:87/126 - (69%) Gaps:5/126 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 KNVLRGKRLAKKKAWQRFVIDCACVAEDMILDLADFEQYLKTHIKIKNKLNQL-KDQVTFERTKN 240
            |.|::|.:  |||...:|.:||....||.|:|.|:|||:|:..||:..|...| ...||.||:|:
Human     6 KLVVKGGK--KKKQVLKFTLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVTIERSKS 68

  Fly   241 FSLIIHSGVHFSKRYFKYLTKRYLKKVSLRDWLRVVSTAKDTFAMTYFKI-QDKDFDDDDD 300
             .:.:.|.|.|||||.|||||:||||.:||||||||:.:|:::.:.||:| ||::.::|:|
Human    69 -KITVTSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANSKESYELRYFQINQDEEEEEDED 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL22-likeNP_611771.1 Ribosomal_L22e 189..291 CDD:280028 50/103 (49%)
RPL22NP_000974.1 Ribosomal_L22e 21..119 CDD:396370 49/98 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3434
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S589
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1594080at2759
OrthoFinder 1 1.000 - - FOG0001115
OrthoInspector 1 1.000 - - mtm8558
orthoMCL 1 0.900 - - OOG6_101015
Panther 1 1.100 - - O PTHR10064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X685
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.730

Return to query results.
Submit another query.