DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL22-like and rpl22

DIOPT Version :9

Sequence 1:NP_611771.1 Gene:RpL22-like / 37684 FlyBaseID:FBgn0034837 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001032766.1 Gene:rpl22 / 557397 ZFINID:ZDB-GENE-051113-276 Length:127 Species:Danio rerio


Alignment Length:125 Identity:58/125 - (46%)
Similarity:84/125 - (67%) Gaps:5/125 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 KNVLRGKRLAKKKAWQRFVIDCACVAEDMILDLADFEQYLKTHIKIKNKLNQL-KDQVTFERTKN 240
            |.|.:|.:  |||...:|.:||....||.|:|.|:|||:|:..||:..|...| ...|:.||:|:
Zfish     6 KQVTKGGK--KKKQVLKFTLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVSIERSKS 68

  Fly   241 FSLIIHSGVHFSKRYFKYLTKRYLKKVSLRDWLRVVSTAKDTFAMTYFKI-QDKDFDDDD 299
             .:.:.|.|.|||||.|||||:||||.:||||||||:..|:::.:.||:| ||::.:|:|
Zfish    69 -KITVTSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANTKESYELRYFQINQDEEEEDED 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL22-likeNP_611771.1 Ribosomal_L22e 189..291 CDD:280028 49/103 (48%)
rpl22NP_001032766.1 Ribosomal_L22e 16..119 CDD:280028 49/103 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3434
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1594080at2759
OrthoFinder 1 1.000 - - FOG0001115
OrthoInspector 1 1.000 - - mtm6614
orthoMCL 1 0.900 - - OOG6_101015
Panther 1 1.100 - - O PTHR10064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X685
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.780

Return to query results.
Submit another query.