DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL22-like and rpl22l1

DIOPT Version :9

Sequence 1:NP_611771.1 Gene:RpL22-like / 37684 FlyBaseID:FBgn0034837 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001011427.1 Gene:rpl22l1 / 496910 XenbaseID:XB-GENE-6073103 Length:120 Species:Xenopus tropicalis


Alignment Length:113 Identity:51/113 - (45%)
Similarity:69/113 - (61%) Gaps:2/113 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 KKAWQRFVIDCACVAEDMILDLADFEQYLKTHIKIKNKLNQLKDQVTFERTKNFSLIIHSGVHFS 252
            ||||. |.:|.....||.|.|..:|||:||..||:..|...|...|...|.|: .:.:.|...||
 Frog    10 KKAWS-FTLDLTHPVEDGIFDSVNFEQFLKERIKVNGKTGNLGSIVHIGRLKS-KITVSSEKKFS 72

  Fly   253 KRYFKYLTKRYLKKVSLRDWLRVVSTAKDTFAMTYFKIQDKDFDDDDD 300
            |||.|||||:||||.:||||||||::.|:|:.:.||:|...|..:.::
 Frog    73 KRYLKYLTKKYLKKNNLRDWLRVVASDKETYELRYFQISQDDESESEE 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL22-likeNP_611771.1 Ribosomal_L22e 189..291 CDD:280028 48/101 (48%)
rpl22l1NP_001011427.1 Ribosomal_L22e 15..112 CDD:366802 46/97 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1594080at2759
OrthoFinder 1 1.000 - - FOG0001115
OrthoInspector 1 1.000 - - mtm9450
Panther 1 1.100 - - O PTHR10064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X685
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.