DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL22-like and Rpl22l1

DIOPT Version :9

Sequence 1:NP_611771.1 Gene:RpL22-like / 37684 FlyBaseID:FBgn0034837 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001102018.1 Gene:Rpl22l1 / 361923 RGDID:1309517 Length:122 Species:Rattus norvegicus


Alignment Length:115 Identity:54/115 - (46%)
Similarity:74/115 - (64%) Gaps:3/115 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 KKKAWQRFVIDCACVAEDMILDLADFEQYLKTHIKIKNKLNQLKDQVTFERTKNFSLIIHSGVHF 251
            ||..| ||.:|.....||.|.|..:|||:|:..:|:..|...|.:.|..||.|| .:.:.|...|
  Rat    10 KKSTW-RFHLDLTHPVEDGIFDSGNFEQFLREKVKVNGKTGNLGNVVHIERLKN-KITVVSEKQF 72

  Fly   252 SKRYFKYLTKRYLKKVSLRDWLRVVSTAKDTFAMTYFKI-QDKDFDDDDD 300
            ||||.|||||:||||.:||||||||::.|:|:.:.||:| ||:|..:.:|
  Rat    73 SKRYLKYLTKKYLKKNNLRDWLRVVASDKETYELRYFQISQDEDGSESED 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL22-likeNP_611771.1 Ribosomal_L22e 189..291 CDD:280028 48/102 (47%)
Rpl22l1NP_001102018.1 Ribosomal_L22e 16..113 CDD:396370 46/97 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3434
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1594080at2759
OrthoFinder 1 1.000 - - FOG0001115
OrthoInspector 1 1.000 - - mtm9034
orthoMCL 1 0.900 - - OOG6_101015
Panther 1 1.100 - - O PTHR10064
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X685
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.