DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL22-like and RPL22L1

DIOPT Version :9

Sequence 1:NP_611771.1 Gene:RpL22-like / 37684 FlyBaseID:FBgn0034837 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001093115.1 Gene:RPL22L1 / 200916 HGNCID:27610 Length:122 Species:Homo sapiens


Alignment Length:118 Identity:54/118 - (45%)
Similarity:75/118 - (63%) Gaps:3/118 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 RLAKKKAWQRFVIDCACVAEDMILDLADFEQYLKTHIKIKNKLNQLKDQVTFERTKNFSLIIHSG 248
            |..|:..| ||.:|.....||.|.|..:|||:|:..:|:..|...|.:.|..||.|| .:.:.|.
Human     7 RKPKRSTW-RFNLDLTHPVEDGIFDSGNFEQFLREKVKVNGKTGNLGNVVHIERFKN-KITVVSE 69

  Fly   249 VHFSKRYFKYLTKRYLKKVSLRDWLRVVSTAKDTFAMTYFKI-QDKDFDDDDD 300
            ..|||||.|||||:||||.:||||||||::.|:|:.:.||:| ||:|..:.:|
Human    70 KQFSKRYLKYLTKKYLKKNNLRDWLRVVASDKETYELRYFQISQDEDESESED 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL22-likeNP_611771.1 Ribosomal_L22e 189..291 CDD:280028 48/102 (47%)
RPL22L1NP_001093115.1 Ribosomal_L22e 16..113 CDD:366802 46/97 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3434
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1594080at2759
OrthoFinder 1 1.000 - - FOG0001115
OrthoInspector 1 1.000 - - mtm8558
orthoMCL 1 0.900 - - OOG6_101015
Panther 1 1.100 - - O PTHR10064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X685
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.