DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LS2 and AT1G60830

DIOPT Version :10

Sequence 1:NP_611769.2 Gene:LS2 / 37681 FlyBaseID:FBgn0034834 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_564764.1 Gene:AT1G60830 / 842376 AraportID:AT1G60830 Length:111 Species:Arabidopsis thaliana


Alignment Length:109 Identity:45/109 - (41%)
Similarity:65/109 - (59%) Gaps:1/109 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 LQDPGSPTETLCLLNMVRPEELLDDEEFEDIRTDIKQECAKFGEVRSIKIPRPIGQF-PKRGCGK 405
            ||..|:||:.:||..:|..::|.||.|:.||..|:.||..|||.:.::.||||.... |..|.||
plant     2 LQPGGTPTKIVCLTQVVTADDLRDDAEYADIMEDMSQEGGKFGNLVNVVIPRPNPDHDPTPGVGK 66

  Fly   406 VFVQFESVEDSQKALKALSGRKFSGRIVMTSYYDPEKYLADDLQ 449
            ||:::..|:.|.||...::||||.|..|:..||..:||...|.:
plant    67 VFLEYADVDGSSKARSGMNGRKFGGNQVVAVYYPEDKYAQGDYE 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LS2NP_611769.2 U2AF_lg 35..447 CDD:273727 44/105 (42%)
AT1G60830NP_564764.1 U2AF_lg <1..109 CDD:273727 44/106 (42%)

Return to query results.
Submit another query.