DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-V and Btnl3

DIOPT Version :10

Sequence 1:NP_611765.2 Gene:side-V / 37679 FlyBaseID:FBgn0085400 Length:1174 Species:Drosophila melanogaster
Sequence 2:NP_001421660.1 Gene:Btnl3 / 407781 RGDID:1303262 Length:511 Species:Rattus norvegicus


Alignment Length:181 Identity:52/181 - (28%)
Similarity:69/181 - (38%) Gaps:53/181 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EGPLSEILTAVGSEVALPCDLVPGTGIVDKVQLVIWYR---------------QGNVK-PIYTFD 86
            :||...|...:|::..|||.|.|......  ..:.|||               ||.|: |.|   
  Rat    34 KGPAEPITVLLGTDATLPCQLSPKQSAAH--MHIRWYRAQLTPAVLVFHNGQVQGEVQMPEY--- 93

  Fly    87 ARGRPLNLGIPWADESVFNKKAHFHHDTD--PPALRIKNIQTSDAGLYKCRVDFHKSPTRNWRIN 149
             .||...||                ||.|  ..||:|:.:|.||.|||.|:  |....| :..::
  Rat    94 -EGRTQMLG----------------HDIDTGSVALQIQQVQASDDGLYHCQ--FSDGFT-SQEVS 138

  Fly   150 VTVLVPPTALTILDHHGAEIRDQTAGPYLEGDSIDLTCLSSGGVPPPRVSW 200
            :.:.|.......|.|        ..||  |.:.|.:.|.|||..|.|||.|
  Rat   139 IELQVVGLGSAPLVH--------MTGP--ENNGIRVLCSSSGWFPKPRVQW 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VNP_611765.2 V-set 42..153 CDD:462230 34/128 (27%)
Ig_3 178..243 CDD:464046 11/23 (48%)
Ig 274..359 CDD:472250
Ig strand B 280..284 CDD:409353
Ig strand C 294..298 CDD:409353
Ig strand E 320..324 CDD:409353
Ig strand F 334..345 CDD:409353
Ig strand G 355..358 CDD:409353
Ig 400..466 CDD:472250
Ig strand B 403..407 CDD:409353
Ig strand C 416..421 CDD:409353
Ig strand E 438..442 CDD:409353
Ig strand F 452..457 CDD:409353
Ig strand G 465..468 CDD:409353
FN3 719..798 CDD:214495
Btnl3NP_001421660.1 IgV_MOG_like 31..143 CDD:409378 36/133 (27%)
FR1 31..54 CDD:409378 7/19 (37%)
Ig strand A 32..36 CDD:409378 0/1 (0%)
Ig strand A' 39..43 CDD:409378 1/3 (33%)
Ig strand B 46..54 CDD:409378 3/7 (43%)
CDR1 55..63 CDD:409378 1/9 (11%)
Ig strand C 63..68 CDD:409378 0/4 (0%)
FR2 64..68 CDD:409378 0/3 (0%)
CDR2 69..87 CDD:409378 2/17 (12%)
Ig strand C' 73..81 CDD:409378 0/7 (0%)
Ig strand C' 82..85 CDD:409378 0/2 (0%)
FR3 89..129 CDD:409378 19/61 (31%)
Ig strand D 96..101 CDD:409378 1/4 (25%)
Ig strand E 107..115 CDD:409378 3/7 (43%)
Ig strand F 122..130 CDD:409378 5/9 (56%)
CDR3 130..132 CDD:409378 0/1 (0%)
Ig strand G 132..143 CDD:409378 1/11 (9%)
FR4 133..143 CDD:409378 1/10 (10%)
Ig 157..>179 CDD:472250 11/23 (48%)
Ig strand B 162..166 CDD:409505 1/3 (33%)
Ig strand C 176..179 CDD:409505 2/2 (100%)
SPRY <383..498 CDD:470632
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.