| Sequence 1: | NP_611765.2 | Gene: | side-V / 37679 | FlyBaseID: | FBgn0085400 | Length: | 1174 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001421660.1 | Gene: | Btnl3 / 407781 | RGDID: | 1303262 | Length: | 511 | Species: | Rattus norvegicus |
| Alignment Length: | 181 | Identity: | 52/181 - (28%) |
|---|---|---|---|
| Similarity: | 69/181 - (38%) | Gaps: | 53/181 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 38 EGPLSEILTAVGSEVALPCDLVPGTGIVDKVQLVIWYR---------------QGNVK-PIYTFD 86
Fly 87 ARGRPLNLGIPWADESVFNKKAHFHHDTD--PPALRIKNIQTSDAGLYKCRVDFHKSPTRNWRIN 149
Fly 150 VTVLVPPTALTILDHHGAEIRDQTAGPYLEGDSIDLTCLSSGGVPPPRVSW 200 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| side-V | NP_611765.2 | V-set | 42..153 | CDD:462230 | 34/128 (27%) |
| Ig_3 | 178..243 | CDD:464046 | 11/23 (48%) | ||
| Ig | 274..359 | CDD:472250 | |||
| Ig strand B | 280..284 | CDD:409353 | |||
| Ig strand C | 294..298 | CDD:409353 | |||
| Ig strand E | 320..324 | CDD:409353 | |||
| Ig strand F | 334..345 | CDD:409353 | |||
| Ig strand G | 355..358 | CDD:409353 | |||
| Ig | 400..466 | CDD:472250 | |||
| Ig strand B | 403..407 | CDD:409353 | |||
| Ig strand C | 416..421 | CDD:409353 | |||
| Ig strand E | 438..442 | CDD:409353 | |||
| Ig strand F | 452..457 | CDD:409353 | |||
| Ig strand G | 465..468 | CDD:409353 | |||
| FN3 | 719..798 | CDD:214495 | |||
| Btnl3 | NP_001421660.1 | IgV_MOG_like | 31..143 | CDD:409378 | 36/133 (27%) |
| FR1 | 31..54 | CDD:409378 | 7/19 (37%) | ||
| Ig strand A | 32..36 | CDD:409378 | 0/1 (0%) | ||
| Ig strand A' | 39..43 | CDD:409378 | 1/3 (33%) | ||
| Ig strand B | 46..54 | CDD:409378 | 3/7 (43%) | ||
| CDR1 | 55..63 | CDD:409378 | 1/9 (11%) | ||
| Ig strand C | 63..68 | CDD:409378 | 0/4 (0%) | ||
| FR2 | 64..68 | CDD:409378 | 0/3 (0%) | ||
| CDR2 | 69..87 | CDD:409378 | 2/17 (12%) | ||
| Ig strand C' | 73..81 | CDD:409378 | 0/7 (0%) | ||
| Ig strand C' | 82..85 | CDD:409378 | 0/2 (0%) | ||
| FR3 | 89..129 | CDD:409378 | 19/61 (31%) | ||
| Ig strand D | 96..101 | CDD:409378 | 1/4 (25%) | ||
| Ig strand E | 107..115 | CDD:409378 | 3/7 (43%) | ||
| Ig strand F | 122..130 | CDD:409378 | 5/9 (56%) | ||
| CDR3 | 130..132 | CDD:409378 | 0/1 (0%) | ||
| Ig strand G | 132..143 | CDD:409378 | 1/11 (9%) | ||
| FR4 | 133..143 | CDD:409378 | 1/10 (10%) | ||
| Ig | 157..>179 | CDD:472250 | 11/23 (48%) | ||
| Ig strand B | 162..166 | CDD:409505 | 1/3 (33%) | ||
| Ig strand C | 176..179 | CDD:409505 | 2/2 (100%) | ||
| SPRY | <383..498 | CDD:470632 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||