DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-V and CG31773

DIOPT Version :9

Sequence 1:NP_611765.2 Gene:side-V / 37679 FlyBaseID:FBgn0085400 Length:1174 Species:Drosophila melanogaster
Sequence 2:NP_722953.1 Gene:CG31773 / 326159 FlyBaseID:FBgn0051773 Length:758 Species:Drosophila melanogaster


Alignment Length:340 Identity:62/340 - (18%)
Similarity:109/340 - (32%) Gaps:129/340 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   511 KWHFNNSLESLIELPQLGQGAPVMLASGSDQSGYYQRSKRKHSHGMQQRLLHGRHGRMAAVRFED 575
            |..|:.:......:|  ||.:|...::.......:|:...|.:                      
  Fly   142 KNQFSQANNPSFAMP--GQSSPANFSAAPKTQASWQQKVEKSA---------------------- 182

  Fly   576 EDEDGYGEFEEYGDEVGQPFTQMVYSNMVHKNHVESSKQQQRKQLSPQQQQQQQQMASGGSSGDS 640
            |:||. |.|:....|..:       .|.:  |.::.|:|:::.|...:.|.:||           
  Fly   183 ENEDS-GAFKGASSESQR-------KNWM--NRMQGSQQRKQNQWLKEMQAKQQ----------- 226

  Fly   641 HTPSGGVILERKRLVALHKQHHRGGVATPPTTTAAPPLNNVYSYHVESYESFGAISCVASSPMGH 705
                .|..::.:::..:..|.     ||  ||.||||.                 ....|:|   
  Fly   227 ----AGKDIQAQKMQKMESQK-----AT--TTPAAPPK-----------------EAAPSTP--- 260

  Fly   706 SAPCWYHIQPADLPEPVKNCTAYNATANSLQIQCIPGYDGGIPQHF-HAQIYDELNR-QILYNAS 768
                    |||:.||...                        |:|. :.....:||. |:|...|
  Fly   261 --------QPAEKPEEKS------------------------PEHLAYLDAIKQLNSYQVLEPTS 293

  Fly   769 YKYSEFTVK--RLPSDSVFVIRITAVNAQGASKVAYRLRGRTLSA-PLLRTA------SSTAVLV 824
               ...|.|  |...|.|....:..:...|.:|       :.|.| |:::.|      |:.|::.
  Fly   294 ---GRATTKSSRKEQDPVIEQTLECLEKSGLTK-------KDLKAIPVIQVAGSKGRGSTCAIVE 348

  Fly   825 QLTPLLGALVGVIAT 839
            .:....|...||:::
  Fly   349 SILRCHGVKTGVLSS 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VNP_611765.2 Ig 42..153 CDD:299845
IG_like 42..152 CDD:214653
IGc2 179..245 CDD:197706
IG_like 179..245 CDD:214653
Ig <282..348 CDD:299845
IGc2 400..459 CDD:197706
FN3 719..798 CDD:214495 15/82 (18%)
CG31773NP_722953.1 folC 309..745 CDD:273659 11/62 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.