DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-V and CG30350

DIOPT Version :9

Sequence 1:NP_611765.2 Gene:side-V / 37679 FlyBaseID:FBgn0085400 Length:1174 Species:Drosophila melanogaster
Sequence 2:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster


Alignment Length:136 Identity:33/136 - (24%)
Similarity:48/136 - (35%) Gaps:32/136 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   881 LSRNMGSHSSLEDKNPDVV------PQEANSEDEFHQEEKAFDR----LNMESQRILYTPPTRIN 935
            :||.|.:|.::.....|.|      |....:.::..::.:.|.|    :|.|....|.....|..
  Fly   110 ISRTMRTHGAINPFRYDTVHAVSSIPMALLTLEKLERDNRDFGRRILEVNSEVDSGLSDKRMREG 174

  Fly   936 TASPP--PPSLSPTFGKQY-----------GELSLTTNPA--FSLYNTPQRAP----AVQRPVYT 981
            .:|.|  |..|.|....:|           .||.....|.  |.||....| |    .||  :||
  Fly   175 RSSTPVAPLELPPQAMAKYEAFNIPLPKSDAELRRLFRPRIYFDLYLKDAR-PLGRFVVQ--LYT 236

  Fly   982 APPPLL 987
            ...||:
  Fly   237 EAAPLV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VNP_611765.2 Ig 42..153 CDD:299845
IG_like 42..152 CDD:214653
IGc2 179..245 CDD:197706
IG_like 179..245 CDD:214653
Ig <282..348 CDD:299845
IGc2 400..459 CDD:197706
FN3 719..798 CDD:214495
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590 9/44 (20%)
cyclophilin 212..369 CDD:294131 12/34 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.