DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13544 and spata17

DIOPT Version :9

Sequence 1:NP_611761.1 Gene:CG13544 / 37673 FlyBaseID:FBgn0034826 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001135736.1 Gene:spata17 / 799739 ZFINID:ZDB-GENE-111214-1 Length:357 Species:Danio rerio


Alignment Length:337 Identity:75/337 - (22%)
Similarity:118/337 - (35%) Gaps:123/337 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 KQYKAARTIQNNWRKFYFRKYFKDLRKAVITIQRWWRGFSVRKNHFRYVENLLQKRVQ------- 113
            |:.:||..||:.:|....|.|.:.|.|..|.||:.||||:.|.        |.::||:       
Zfish    32 KENEAAVRIQSWFRGCQVRAYIRHLHKNAILIQKTWRGFTARA--------LFRQRVKTAYFIMK 88

  Fly   114 -DHHHRAATKIQALFRGWKSRRTIHDH-------SKLLRKQVCAAEDLLNCVAF----------- 159
             :.:::.|.|||..:||:..|:.:|::       ..|.||......||.....|           
Zfish    89 MNFYNKMAVKIQQRWRGFYVRKYVHNYYARKRYLEGLTRKNEHIRRDLEEFAEFQRRERERIALE 153

  Fly   160 -----------KLHHLLRTFAIPGVYSLKNSNCMSRVEKLLASLHFRFHNGRVKTQLAK------ 207
                       :||.||.|...|||:     |...|.|.....|..|    .||..|.:      
Zfish   154 KEEQEKKIQAQRLHFLLSTKQCPGVF-----NSPFRAEPDEMELRLR----TVKPLLVRSAPKER 209

  Fly   208 -------ELADRGKDTETFKRSNKFSKVPFEGARYWSQCKPKCEAALKMSKNIERRMYRIIEIYD 265
                   :|:....:.|.....:|.::.||         :|..|        ::::.||.:|   
Zfish   210 KTPNITPDLSSVMPNRERLPPIHKKTQGPF---------RPALE--------VQQQRYRPLE--- 254

  Fly   266 ASQREAHA--ALVEKNRAYRKHKGLMQNIKKSAEKSKRDFCGDVIASMRRWKILVDNDLTVDKNI 328
            .|.|.|.:  ||.|.....:.|:                           |:..|     :|:..
Zfish   255 PSLRVATSITALEEAREELKLHE---------------------------WRTRV-----IDQTF 287

  Fly   329 --FKNPQNLERF 338
              |.||...:|:
Zfish   288 LPFSNPSRNKRY 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13544NP_611761.1 COG5022 <12..>301 CDD:227355 68/296 (23%)
spata17NP_001135736.1 COG5022 <87..>161 CDD:227355 14/73 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592587
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CGXK
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22706
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6126
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.