DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13544 and Spata17

DIOPT Version :9

Sequence 1:NP_611761.1 Gene:CG13544 / 37673 FlyBaseID:FBgn0034826 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_083124.1 Gene:Spata17 / 74717 MGIID:1921967 Length:379 Species:Mus musculus


Alignment Length:331 Identity:69/331 - (20%)
Similarity:120/331 - (36%) Gaps:113/331 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 AARTIQNNWRKFYFRKYFKDLRKAVITIQRWWRGFSVRKNHFRYVENLLQKRVQDHHHRAATKIQ 124
            ||..||:.:|....|.|.:.|.:.|..||:|||.:..||.:...||........:.::..|.:||
Mouse    51 AAVMIQSWFRGCQVRAYMRHLNRVVTIIQKWWRSYLGRKFYQLVVEAAYYTMKMNLYNEMAVRIQ 115

  Fly   125 ALFRGWKSR-------------RTIHDHSKLLRKQVCAAEDLL-------------------NCV 157
            ..:||::.|             |.:.:.:..:|:   |.|:..                   :..
Mouse   116 RRWRGFRIRKYCFNYYYLKEYLRAVSETNDAIRE---ALEEFAEMKEREERKVLLEREEKQKDYQ 177

  Fly   158 AFKLHHLLRTFAIPGVYSLKNSNCMSRVEKLLASLHFRFHNG--RVKTQLAKEL------ADRGK 214
            |.|:|:||.|..|.|:|   ||             .||.|..  .::.|.||.|      |::||
Mouse   178 ARKMHYLLSTKQISGIY---NS-------------PFREHPDPWELRLQKAKPLGHQKYTAEKGK 226

  Fly   215 DTE------------TFKRSNKFSKV-------PFEG------ARYWSQCKPKCEAALKMS---- 250
            .::            :|.:|.....:       ||..      .||    || .|..|:::    
Mouse   227 TSQSPSNWLACTSVHSFPQSESLPPISRKRCQGPFRDINEVLEQRY----KP-LEPTLRVAEPIN 286

  Fly   251 ---------------KNIERRMYRIIEIYDASQREAHAALVEKNRAYRKHKGLMQNIKKSAEK-- 298
                           :|::.:|:.....|  .::|.:..::..:.||.......::.:....|  
Mouse   287 HLRLAREAFKQEERMRNVQDKMFLPFSSY--HKKEKYIPMIHSSSAYNSDSYGQKHFRSQDSKKW 349

  Fly   299 -SKRDF 303
             |.:||
Mouse   350 ISDKDF 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13544NP_611761.1 COG5022 <12..>301 CDD:227355 67/327 (20%)
Spata17NP_083124.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847348
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CGXK
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22706
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6126
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.