DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13544 and Spata17

DIOPT Version :9

Sequence 1:NP_611761.1 Gene:CG13544 / 37673 FlyBaseID:FBgn0034826 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_006250511.1 Gene:Spata17 / 498305 RGDID:1565282 Length:363 Species:Rattus norvegicus


Alignment Length:253 Identity:56/253 - (22%)
Similarity:89/253 - (35%) Gaps:77/253 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 AARTIQNNWRKFYFRKYFKDLRKAVITIQRWWRGFSVRKNHFRYVENLLQKRVQDHHHRAATKIQ 124
            ||..||:.:|....|.|.:.|.:.|..||:|||.:..||.:...||........:.::..|.:||
  Rat    35 AAVAIQSWFRGCQVRAYIRHLNRVVTIIQKWWRSYLGRKYYQLIVEAAYYTMKMNLYNEMAVRIQ 99

  Fly   125 ALFRGWKSR-------------RTIHDHSKLLRKQVCAAEDLL-------------------NCV 157
            ..:||::.|             |.:.:.:..:|:   |.|:..                   :..
  Rat   100 RRWRGFRIRKYCFNYYYLKEYLRAVSETNDAIRE---ALEEFAEMKEREERKILLELEEKQKDYQ 161

  Fly   158 AFKLHHLLRTFAIPGVYSLKNSNCMSRVEKLLASLHFRFHNG--RVKTQLAKELADRGKDTETFK 220
            |.|.|:||.|..|.|||   ||             .||.|..  .|:.|.||.|..|.......|
  Rat   162 ARKTHYLLSTKQISGVY---NS-------------PFREHPDPWEVRLQKAKPLEHRKGSAMKSK 210

  Fly   221 RSNKFSKVPFEGARYWSQC----------------KPKCEAALKMSKNIERRMYRIIE 262
            .::..|.        |..|                :.:|:...:....:..:.|:.:|
  Rat   211 TAHSLSS--------WLACTSARSFPRSASLPPIDRKRCQGPFRDINEVLEQRYKPLE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13544NP_611761.1 COG5022 <12..>301 CDD:227355 56/253 (22%)
Spata17XP_006250511.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350901
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CGXK
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22706
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6126
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.