DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13544 and CG31735

DIOPT Version :9

Sequence 1:NP_611761.1 Gene:CG13544 / 37673 FlyBaseID:FBgn0034826 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_723937.3 Gene:CG31735 / 318922 FlyBaseID:FBgn0051735 Length:312 Species:Drosophila melanogaster


Alignment Length:291 Identity:106/291 - (36%)
Similarity:158/291 - (54%) Gaps:1/291 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 AARTIQNNWRKFYFRKYFKDLRKAVITIQRWWRGFSVRKNHFRYVENLLQKRVQDHHHRAATKIQ 124
            |||.||:.||.:..||......::.|.||||||||..|...:..||..||..:.:|.||||.:||
  Fly     4 AARRIQSFWRGYRVRKLLHLRWQSAIAIQRWWRGFRTRHILYEKVERRLQGIIHEHFHRAAIRIQ 68

  Fly   125 ALFRGWKSRRTIHDHSKLLRKQVCAAEDLLNCVAFKLHHLLRTFAIPGVYSLKNSNCMSRVEKLL 189
            ||||||..|:.|||...|.|.|..|||||:||:..::||:.:|.:||||.||:||.|.|:|||||
  Fly    69 ALFRGWWVRKFIHDVRNLHRMQCTAAEDLINCIIHEMHHIKKTDSIPGVISLRNSVCRSKVEKLL 133

  Fly   190 ASLHFRFHNGRVKTQLAKELADRGKDTETFKRSNKFSKVPFEGARYWSQCKPKCEAALKMSK-NI 253
            .::.||||||||.:.:|..::.:.:....|:.:...:.:|:.|..:...|..:.:..:.:.: ..
  Fly   134 TTMIFRFHNGRVLSMVANRMSQKEEYRRHFRDARFVTHIPYSGPNFDGLCYVREDDHIVLKEVPT 198

  Fly   254 ERRMYRIIEIYDASQREAHAALVEKNRAYRKHKGLMQNIKKSAEKSKRDFCGDVIASMRRWKILV 318
            :.|...|:..|:.||...|..........||.:..:.:|.......||.||.|||..||:|.|..
  Fly   199 DLRYSEIVTEYEESQLHEHLRETHLRFDLRKLQRQIDHINYQELHLKRKFCADVIDRMRKWTIWD 263

  Fly   319 DNDLTVDKNIFKNPQNLERFVAEISQYANEF 349
            .......:||:::.:|.:.|........::|
  Fly   264 SISANHKQNIYESRKNTQVFFRRAEHLMSDF 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13544NP_611761.1 COG5022 <12..>301 CDD:227355 90/241 (37%)
CG31735NP_723937.3 COG5022 <4..>79 CDD:227355 37/74 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464969
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CGXK
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014388
OrthoInspector 1 1.000 - - otm47562
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6126
65.740

Return to query results.
Submit another query.