DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13544 and SPATA17

DIOPT Version :9

Sequence 1:NP_611761.1 Gene:CG13544 / 37673 FlyBaseID:FBgn0034826 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001362584.1 Gene:SPATA17 / 128153 HGNCID:25184 Length:361 Species:Homo sapiens


Alignment Length:245 Identity:55/245 - (22%)
Similarity:95/245 - (38%) Gaps:54/245 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 KQYKAARTIQNNWRKFYFRKYFKDLRKAVITIQRWWRGFSVRKNHFRYVENLLQKRVQDHHHRAA 120
            |:..||..||:.:|....|.|.:.|.:.|..||:|||.|..||.:...|:......:.:.::..|
Human    31 KENDAAVKIQSWFRGCQVRAYIRHLNRIVTIIQKWWRSFLGRKQYQLTVQVAYYTMMMNLYNAMA 95

  Fly   121 TKIQALFRGWKSRRTIHDHSKLLR--KQVCAAEDLL---------------------------NC 156
            .:||..:||::.|:.:.::..|..  |.|....|.:                           :.
Human    96 VRIQRRWRGYRVRKYLFNYYYLKEYLKVVSETNDAIRKALEEFAEMKEREEKKANLEREEKKRDY 160

  Fly   157 VAFKLHHLLRTFAIPGVYSLKNSNCMS-------RVEKLLASLHFRFHNGRVKTQLAKELAD--R 212
            .|.|:|:||.|..|||:|   ||....       :::|.....|.|   .:||.:.:..|.|  .
Human   161 QARKMHYLLSTKQIPGIY---NSPFRKEPDPWELQLQKAKPLTHRR---PKVKQKDSTSLTDWLA 219

  Fly   213 GKDTETFKRSNKFSKVPFEGARYWSQCKPKCEAALKMSKNIERRMYRIIE 262
            .....:|.||.....:.          :.:|:...:....:..:.||.:|
Human   220 CTSARSFPRSEILPPIN----------RKQCQGPFRDITEVLEQRYRPLE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13544NP_611761.1 COG5022 <12..>301 CDD:227355 55/245 (22%)
SPATA17NP_001362584.1 IQ 55..76 CDD:197470 10/20 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156945
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CGXK
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22706
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6126
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.