DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp59C and Klp98A

DIOPT Version :9

Sequence 1:NP_611759.1 Gene:Klp59C / 37671 FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_524532.2 Gene:Klp98A / 43310 FlyBaseID:FBgn0004387 Length:1265 Species:Drosophila melanogaster


Alignment Length:374 Identity:121/374 - (32%)
Similarity:182/374 - (48%) Gaps:53/374 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 IMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHEPRKHVNLVKFLENHSFRFDY---VFDEE-- 247
            :.|.||.||...:|:....|.::.:.:|.|.::....:.:.......:|.|.|||   .||.|  
  Fly     4 LKVAVRVRPFNSREIDMDAQLIMEMENKKTRLLKPRLQSIRDAGRDNHHDFTFDYSYWSFDAEDP 68

  Fly   248 --CSNATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSMDGIYAMAAKDV 310
              .:...||......::...::|..|..|||||||||||:||.|      ..:..|:.....:::
  Fly    69 HFATQEQVYSDLGNDVVDCAYEGYNACVFAYGQTGSGKTFTMMG------TPNNPGLIPRICEEL 127

  Fly   311 FSTLKTVPYNKLNLKVYCSFFEIYGTRVFDLLMPGKP--QLRVLEDRNQQVQVVGLTQNPVQNTA 373
            |:.::....:....:.:.|:.|||..||.|||.....  .|||.|.|:....|..|:|:.|.:..
  Fly   128 FARMRVGQESGTGYRTHASYLEIYNERVKDLLAAQSTGHGLRVREHRSLGPYVENLSQHAVSDFD 192

  Fly   374 EVLDLLELGNSVRTSGHTSANSKSSRSHAVFQIV---------LRSAAGEKLHGKFSLIDLAGNE 429
            |:.:.:..||:.||:..|:.|..||||||:|.|.         :.|....|:|    |:||||:|
  Fly   193 EIQECIARGNAQRTTASTNMNDTSSRSHAIFTITFVQAVFMNDMPSETVSKIH----LVDLAGSE 253

  Fly   430 RGADNSSADRQTRLEGSEINKSLLVLKECIRALGRQSS----------------------HLPFR 472
            | |:.:.|..|...||:.|||||:.|...|.||..|:.                      ::|:|
  Fly   254 R-ANATGATGQRLKEGAHINKSLVTLGSVISALAEQTGGGHNSSSSALATTPNGASKRVLYIPYR 317

  Fly   473 GSKLTQVLRDSFIGGKKVKTCMIAMISPCLHSVEHTLNTLRYADRVKEL 521
            .|.||.:|:|| :||.. ||.|||.:||...:...||:|||||:|.|.:
  Fly   318 DSILTWLLKDS-LGGNS-KTIMIAALSPADCNYSETLSTLRYANRAKNI 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 120/370 (32%)
Kinesin 193..520 CDD:278646 118/366 (32%)
Klp98ANP_524532.2 KISc_KIF1A_KIF1B 2..371 CDD:276816 121/374 (32%)
KISc 3..371 CDD:214526 121/374 (32%)
Kinesin_assoc 370..478 CDD:292801
FHA 456..555 CDD:238017
PX_KIF16B_SNX23 1131..1259 CDD:132784
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437719
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.