DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp59C and pav

DIOPT Version :9

Sequence 1:NP_611759.1 Gene:Klp59C / 37671 FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_477025.1 Gene:pav / 38515 FlyBaseID:FBgn0011692 Length:887 Species:Drosophila melanogaster


Alignment Length:537 Identity:131/537 - (24%)
Similarity:215/537 - (40%) Gaps:147/537 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 PGNPNWEVARMIRLQREQMESQRVRSGTTNERINCHQIMVCVRKRPLRRKELADREQDVVSIPSK 215
            |..|...|.:..|:.:...:.:|..|....:.:|     |..|.|||:      .:.|:.|:..|
  Fly     5 PRTPMRVVPKTPRVHQTVEKQRRDTSDKARDPVN-----VFCRVRPLQ------SDADLTSLRVK 58

  Fly   216 H-TLVVHEPRKHVNLVKFLENH----------SFRFDYVFDEECSNATVYEFTARPLIKHIFDGG 269
            : |.:...|:.     :.|::|          .:.|.:||..:.:...||...|:||::::..|.
  Fly    59 NSTTIALNPQD-----QLLQHHKPHNGAQREVQYIFKHVFQPDATQQDVYAAVAQPLVENLLKGR 118

  Fly   270 MATCFAYGQTGSGKTYTMGGQFPGRHQSSM----------------------------------- 299
            .:..|.||.|||||||||.|..  ||:..|                                   
  Fly   119 NSLLFTYGVTGSGKTYTMTGNL--RHRGIMPRCLDVLFRTISDYQAKKFVFKPDKLNGFEILSEE 181

  Fly   300 ----------------DGIYAMAAKD----VFSTLKTVPYNKLNL------KVYCSFFEIYGTRV 338
                            .|.:|...||    :.|.....|...|.|      .|:.::.|||...|
  Fly   182 DALLERQHEMNQRFAGSGRFAFRHKDSDPEIASQASVEPIPLLGLDEDNMYSVFVTYIEIYNNSV 246

  Fly   339 FDLLMPGKPQLR-----VLEDRNQQVQVVGLTQNPVQNTAEVLDLLELGNSVRTSGHTSANSKSS 398
            :|||.....|..     :.||.|:.:.|.|:|:..|:...:.|::.::|...:..|||..|::||
  Fly   247 YDLLEDSGIQKTLQSKIIREDANRHMFVHGVTEVEVKTVEDALEVFQMGQKRKRMGHTVLNAESS 311

  Fly   399 RSHAVFQIVLRSA----AGEKL--------HGKFSLIDLAGNERGADNSSADRQTRLEGSEINKS 451
            |||:||.|.|..|    .||.:        ..:.||:||||:||.:...:...:.| |...||.|
  Fly   312 RSHSVFNIRLVQAPTDSQGENVVQDRQNITVSQLSLVDLAGSERSSRTKNTGVRLR-EAGNINNS 375

  Fly   452 LLVLKECIRAL---------GRQSSHLPFRGSKLTQVLRDSFIGGKKVKTCMIAMISPCLHSVEH 507
            |:.|:.|:..|         |.....:|:|.||:|.:.::.|.|..:|.  ||..|:|.:...:.
  Fly   376 LMTLRTCLEYLRENQLAASNGLAPKKVPYRDSKITHMFKNYFDGEGQVS--MIVCINPRIEDYDE 438

  Fly   508 TLNTLRYADRVKELSV-ESIPSKRMPDANLGSTSMSDIVCQSSTQRLFPCASSTSMPGGGNQAQQ 571
            .:..:::|:..:|:.: .:.|.|:    :||.|.     .:....:||..|              
  Fly   439 NMQVMKFAEMTQEVQIARATPMKQ----DLGLTP-----GRRKANKLFKIA-------------- 480

  Fly   572 HTNTANDLNRSQKPTSK 588
                .|:||....|.:|
  Fly   481 ----VNNLNELGIPEAK 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 110/429 (26%)
Kinesin 193..520 CDD:278646 109/424 (26%)
pavNP_477025.1 KISc_KIF23_like 35..450 CDD:276819 111/435 (26%)
Kinesin 42..452 CDD:278646 109/425 (26%)
MKLP1_Arf_bdg 735..837 CDD:293148
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437813
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.