DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp59C and unc-104

DIOPT Version :9

Sequence 1:NP_611759.1 Gene:Klp59C / 37671 FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_611155.3 Gene:unc-104 / 36876 FlyBaseID:FBgn0267002 Length:1739 Species:Drosophila melanogaster


Alignment Length:376 Identity:138/376 - (36%)
Similarity:203/376 - (53%) Gaps:45/376 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 IMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHE--PRKHVNLVKFLENHSFRFDYVF------ 244
            :.|.||.||...:|:|...:.::.:....|.:.:.  |....:.||     .|.|||.:      
  Fly     4 VKVAVRVRPFNSREIARESKCIIEMAGATTAITNPKVPPNTSDSVK-----RFNFDYSYWSHDHH 63

  Fly   245 DEECS-NATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSMDGIYAMAAK 308
            |.:.| .:.||:.....:::|.|||.....|||||||:||:|||    .||.:...:||..|..|
  Fly    64 DADFSTQSMVYKDIGEEMLQHSFDGYNVCIFAYGQTGAGKSYTM----MGRQEEQQEGIIPMICK 124

  Fly   309 DVFSTLKTVPYNKLNLKVYCSFFEIYGTRVFDLLMP-GKPQLRVLEDRNQQVQVVGLTQNPVQNT 372
            |:|:.::....:.|...|..|:.|||..||.|||.| .|..|||.|.......|..|::..|.:.
  Fly   125 DLFTRIQDTETDDLKYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTDY 189

  Fly   373 AEVLDLLELGNSVRTSGHTSANSKSSRSHAVFQI--------VLRSAAGEKLHGKFSLIDLAGNE 429
            .::.||::.||..||...|:.|..||||||||.|        ::.:...||: .|.||:||||:|
  Fly   190 QDIHDLIDEGNKARTVAATNMNETSSRSHAVFTIFFTQRRHDLMTNLTTEKV-SKISLVDLAGSE 253

  Fly   430 RGADNSSADRQTRL-EGSEINKSLLVLKECIRALG---------RQSSHLPFRGSKLTQVLRDSF 484
            | ||::.| :.||| ||:.|||||..|.:.|.||.         :::..:|:|.|.||.:||:: 
  Fly   254 R-ADSTGA-KGTRLKEGANINKSLTTLGKVISALAEVASKKKNTKKADFIPYRDSALTWLLREN- 315

  Fly   485 IGGKKVKTCMIAMISPCLHSVEHTLNTLRYADRVKELSVESIPSKRMPDAN 535
            :||.. ||.|||.|||...:.:.||:|||||||.|::..:::.::   |||
  Fly   316 LGGNS-KTAMIAAISPADINYDETLSTLRYADRAKQIVCKAVVNE---DAN 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 134/358 (37%)
Kinesin 193..520 CDD:278646 132/354 (37%)
unc-104NP_611155.3 KISc_KIF1A_KIF1B 2..358 CDD:276816 135/367 (37%)
KISc 3..358 CDD:214526 135/367 (37%)
Kinesin_assoc 355..498 CDD:292801 3/11 (27%)
FHA 475..574 CDD:238017
KIF1B 878..923 CDD:289208
DUF3694 1246..1347 CDD:289256
PH_KIFIA_KIFIB 1602..1704 CDD:269939
PH 1607..1700 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437808
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.