DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp59C and Khc-73

DIOPT Version :9

Sequence 1:NP_611759.1 Gene:Klp59C / 37671 FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001261000.1 Gene:Khc-73 / 36718 FlyBaseID:FBgn0019968 Length:1957 Species:Drosophila melanogaster


Alignment Length:459 Identity:147/459 - (32%)
Similarity:231/459 - (50%) Gaps:47/459 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 QIMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHEPRKHVNLVKFLENHSFRFDYVF------D 245
            :|.|.||.||..|:|:....:.:|.:..:.|::.:.|  .:..::..:..:|.||:.|      |
  Fly     5 KIKVAVRVRPFNRREIELDTKCIVEMEKQQTILQNPP--PLEKIERKQPKTFAFDHCFYSLNPED 67

  Fly   246 EE-CSNATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSMDGIYAMAAKD 309
            |. .|..||::...|.::.:.|.|..|..||||||||||:|||.|.     |.| .||.......
  Fly    68 ENFASQETVFDCVGRGILDNAFQGYNACIFAYGQTGSGKSYTMMGT-----QES-KGIIPRLCDQ 126

  Fly   310 VFSTLKTVPYNKLNLKVYCSFFEIYGTRVFDLL--MPGKPQLRVLEDRNQQVQVVGLTQNPVQNT 372
            :||.:......:|..||..|:.|||..:|.|||  .|.|..|:|.|.......|.||:|..|.:.
  Fly   127 LFSAIANKSTPELMYKVEVSYMEIYNEKVHDLLDPKPNKQSLKVREHNVMGPYVDGLSQLAVTSY 191

  Fly   373 AEVLDLLELGNSVRTSGHTSANSKSSRSHAVFQIVL--------RSAAGEKLHGKFSLIDLAGNE 429
            .::.:|:..||..||...|:.|::||||||||.:||        ...:|||: .:.||:||||:|
  Fly   192 QDIDNLMTEGNKSRTVAATNMNAESSRSHAVFSVVLTQILTDQATGVSGEKV-SRMSLVDLAGSE 255

  Fly   430 RGADNSSADRQTRLEGSEINKSLLVLKECIRALGRQSS--------HLPFRGSKLTQVLRDSFIG 486
            |.....:...:.: |||.|||||..|...|..|..||:        .:|:|.|.||.:|:|: :|
  Fly   256 RAVKTGAVGDRLK-EGSNINKSLTTLGLVISKLADQSNGKKSGNDKFVPYRDSVLTWLLKDN-LG 318

  Fly   487 GKKVKTCMIAMISPCLHSVEHTLNTLRYADRVKELSVESIPSKRMPDANLGSTSMSDIVCQSSTQ 551
            |.. :|.|:|.|||...:.|.||:|||||||.|.:...::.::. |:|.:    :.::..:..|.
  Fly   319 GNS-RTVMVATISPSADNYEETLSTLRYADRAKRIVNHAVVNED-PNARI----IRELRHEVETL 377

  Fly   552 RLFPCASSTSMPGGGNQAQ--QHTNTANDLNRS--QKPTSKPTYPTSGQQLVQRKGSSQREASMM 612
            |.. ...:|..|.|..|.:  :..|....::::  :|...........||.:::.|.|.:.:.:.
  Fly   378 RSM-LKHATGSPVGDVQDKLAESENLMKQISQTWEEKLVKTERIQNERQQALEKMGISVQASGIK 441

  Fly   613 LTKS 616
            :.|:
  Fly   442 VEKN 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 131/356 (37%)
Kinesin 193..520 CDD:278646 128/351 (36%)
Khc-73NP_001261000.1 KISc_KIF1A_KIF1B 4..359 CDD:276816 132/365 (36%)
KISc 6..359 CDD:214526 132/364 (36%)
Kinesin_assoc 356..468 CDD:292801 15/96 (16%)
FHA 446..546 CDD:238017 147/459 (32%)
KIF1B 741..786 CDD:289208
DUF3694 <1196..1252 CDD:289256
CAP_GLY 1786..1850 CDD:279625
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437742
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.