DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp59C and CG5004

DIOPT Version :9

Sequence 1:NP_611759.1 Gene:Klp59C / 37671 FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_573195.1 Gene:CG5004 / 32698 FlyBaseID:FBgn0260748 Length:1247 Species:Drosophila melanogaster


Alignment Length:577 Identity:102/577 - (17%)
Similarity:192/577 - (33%) Gaps:202/577 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 QRIATGSLSPVLATAPPRQQTAPPVREDEVVHQAERMRKERERRREAQARTRLDREQGK------ 147
            |.:.:.:.||     .|.::.||..|.   :|..:|.|:|..:||:     :|.||..:      
  Fly   544 QSVESQTQSP-----KPSRKPAPAPRS---IHLEQRQRRELIQRRK-----QLKRELAELPPSAG 595

  Fly   148 --------NEDPGNPNWEVARMIRLQREQ-----MESQRVRSGTTNERINCHQIMVCVRKRPLRR 199
                    .|.|..|:  .:..::||..|     :|:||          |..::|  ...:..:.
  Fly   596 IEGLELKLGEQPLAPS--ASPRLQLQALQNRVCRLEAQR----------NATRVM--EENQQAKL 646

  Fly   200 KELADREQDVVSIPSKHTLVVHEP-----RKHVNLV--------KFLENHSFRFDYVFDEECSNA 251
            |:..:.:||  .:.....::..:|     ::.:.||        |..|:..|::   |:||..:.
  Fly   647 KQSIEIKQD--QLKKLRAMLKQKPNNACLKEELQLVCESLESDRKTFEDLEFQY---FEEESEHH 706

  Fly   252 TVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSM-DGIYAMA--------- 306
            ..:|...|...:.:.:..:|....  |.|..:........||...|:: :|:.:.:         
  Fly   707 ASHEEFKRQEQRLMLEAELAALRI--QIGPDEEEPGSPTSPGSTGSNLVNGVMSQSLFGSAELLC 769

  Fly   307 -----AKDVFSTLKTVPYNKL-NLKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDR---------- 355
                 .:|:.|  |:|..|.. |.|:..           :...|.:..|::.||.          
  Fly   770 PKRRNQEDLMS--KSVNENMFYNHKIEA-----------NTSTPKRLPLQLFEDLAGGSCEQISF 821

  Fly   356 NQQVQVVGLTQNPVQNTAEVLDLLELGNSVRTSGHTSANSKSSRSHAVFQIVLRSAAGEKL---- 416
            |..:|......||::......|  ::..|.:.:.....::....|..:|..::......||    
  Fly   822 NLSLQGDRFEVNPLERRVPSQD--DIDRSCKVANDAPISASQGASTKIFDSIMEIERNRKLLLAQ 884

  Fly   417 -------HGKFSLIDLAGNERGADNS----------SADRQTRLEGSEINKSLLVLKECIRALGR 464
                   |.:..:.||  .::..|.:          |.::|.:|| |:.|               
  Fly   885 QGHQVIEHERQKMYDL--KKKSHDEARTQYLLSTQQSMEQQRQLE-SDAN--------------- 931

  Fly   465 QSSHLPFRGSKLTQVLRDSFIGGKKVKTCMIAMISPCLHSVEHT-LNTLRYA------DRVKELS 522
                                 |||..|.            .|.| |..|...      |:|::::
  Fly   932 ---------------------GGKDAKL------------FEKTELQKLNQKPGEPVDDQVQKIA 963

  Fly   523 VESIPSKRMPDANLGSTSMSDIVCQSSTQRLFPCASSTSMPGGGNQAQQHTNTANDL 579
            .:    |.....|..||..|            |..::|:..|||...||..::..:|
  Fly   964 GD----KENNVQNRKSTGSS------------PTTTTTTTTGGGTTPQQQRHSQPEL 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 62/398 (16%)
Kinesin 193..520 CDD:278646 62/393 (16%)
CG5004NP_573195.1 FHA 41..104 CDD:278899
PH-like 1142..1242 CDD:302622
PH 1143..1237 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437809
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.