DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp59C and CG32318

DIOPT Version :9

Sequence 1:NP_611759.1 Gene:Klp59C / 37671 FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster


Alignment Length:117 Identity:36/117 - (30%)
Similarity:51/117 - (43%) Gaps:21/117 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 VRSGTTN---ERINCHQIMVCVRKRPLRRKELADREQDVV------SIPSKHTLVVHEPRKHVNL 229
            :..|.|:   ::.:...|.|.||.|||..:|...|..:||      .:.::|||.....:|    
  Fly     3 ISGGNTSRQPQKKSNQNIQVYVRVRPLNSRERCIRSAEVVDVVGPREVVTRHTLDSKLTKK---- 63

  Fly   230 VKFLENHSFRFDYVFDEECSNATVYEFTARPLIKHIFDGGMATCFAYGQTGS 281
                    |.||..|..|.....||.....|||:.:.:|...|.|||||||:
  Fly    64 --------FTFDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGN 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 34/101 (34%)
Kinesin 193..520 CDD:278646 31/95 (33%)
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 32/100 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437798
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.