DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37b and RPL37A

DIOPT Version :9

Sequence 1:NP_611757.1 Gene:RpL37b / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_013286.1 Gene:RPL37A / 850882 SGDID:S000004175 Length:88 Species:Saccharomyces cerevisiae


Alignment Length:85 Identity:57/85 - (67%)
Similarity:67/85 - (78%) Gaps:0/85 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKGTTSFGKRHNKTHTICRRCGNSSYHLQKSKCSQCGYPAAKTRSFNWSRKAKGRKAQGTGRMR 65
            |.|||.||||||||:||:|.|||..|:|:||..||.||||||||||:||..|||.|...||||||
Yeast     1 MGKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGAKAKRRHTTGTGRMR 65

  Fly    66 YLKNLRRRFRNGLREGGAAK 85
            |||::.|||:||.:.|.|:|
Yeast    66 YLKHVSRRFKNGFQTGSASK 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37bNP_611757.1 PTZ00073 1..89 CDD:240257 57/85 (67%)
RPL37ANP_013286.1 PTZ00073 1..85 CDD:240257 56/83 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343880
Domainoid 1 1.000 98 1.000 Domainoid score I1602
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I1184
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53564
OrthoFinder 1 1.000 - - FOG0001246
OrthoInspector 1 1.000 - - mtm9186
orthoMCL 1 0.900 - - OOG6_100852
Panther 1 1.100 - - O PTHR10768
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X874
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.