DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37b and AT1G52300

DIOPT Version :9

Sequence 1:NP_611757.1 Gene:RpL37b / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_175640.1 Gene:AT1G52300 / 841660 AraportID:AT1G52300 Length:95 Species:Arabidopsis thaliana


Alignment Length:87 Identity:56/87 - (64%)
Similarity:68/87 - (78%) Gaps:0/87 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKGTTSFGKRHNKTHTICRRCGNSSYHLQKSKCSQCGYPAAKTRSFNWSRKAKGRKAQGTGRMR 65
            |||||.|||||.||:||:|.|||..|:|:|||:||.|.||||:.|::|||.||..||..||||||
plant     1 MTKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTGTGRMR 65

  Fly    66 YLKNLRRRFRNGLREGGAAKKK 87
            ||:|:.|||:.|.|||..||.:
plant    66 YLRNVPRRFKTGFREGTEAKPR 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37bNP_611757.1 PTZ00073 1..89 CDD:240257 56/87 (64%)
AT1G52300NP_175640.1 PTZ00073 1..89 CDD:240257 56/87 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2619
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I1761
OMA 1 1.010 - - QHG53564
OrthoDB 1 1.010 - - D1560654at2759
OrthoFinder 1 1.000 - - FOG0001246
OrthoInspector 1 1.000 - - mtm1080
orthoMCL 1 0.900 - - OOG6_100852
Panther 1 1.100 - - O PTHR10768
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X874
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.