DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37b and RPL37

DIOPT Version :9

Sequence 1:NP_611757.1 Gene:RpL37b / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_000988.1 Gene:RPL37 / 6167 HGNCID:10347 Length:97 Species:Homo sapiens


Alignment Length:87 Identity:58/87 - (66%)
Similarity:68/87 - (78%) Gaps:0/87 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKGTTSFGKRHNKTHTICRRCGNSSYHLQKSKCSQCGYPAAKTRSFNWSRKAKGRKAQGTGRMR 65
            |||||:|||||.|||||:|||||:.:||||||.|.:|||||.:.|.:|||.|||.|...||||||
Human     1 MTKGTSSFGKRRNKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMR 65

  Fly    66 YLKNLRRRFRNGLREGGAAKKK 87
            :||.:.||||:|.|||...|.|
Human    66 HLKIVYRRFRHGFREGTTPKPK 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37bNP_611757.1 PTZ00073 1..89 CDD:240257 58/87 (67%)
RPL37NP_000988.1 PTZ00073 1..88 CDD:240257 58/87 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7200
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53564
OrthoDB 1 1.010 - - D1560654at2759
OrthoFinder 1 1.000 - - FOG0001246
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100852
Panther 1 1.100 - - O PTHR10768
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X874
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.