DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-2 and kcnq5b

DIOPT Version :10

Sequence 1:NP_611757.1 Gene:RpL37-2 / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster
Sequence 2:XP_697081.5 Gene:kcnq5b / 568646 ZFINID:ZDB-GENE-090312-178 Length:974 Species:Danio rerio


Alignment Length:91 Identity:23/91 - (25%)
Similarity:35/91 - (38%) Gaps:28/91 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SFGKRH----NKTHTICRRCGN---SSYHL-------------QKSKCSQCGYPAA-KTRSFNWS 50
            |:|..:    |:....|.|.|:   |:.|.             |.::.|..|.|.. .|:|  ..
Zfish    26 SYGLHNVECDNRMKNNCSRPGDGLLSASHAGTGASGTERDRGKQGARLSLLGKPLVYGTQS--GR 88

  Fly    51 RKAKGRKAQGTGRMRYLKNLRRRFRN 76
            |.|:.|:.|     .||.|:..|.|:
Zfish    89 RNARYRRIQ-----NYLYNVLERPRS 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-2NP_611757.1 PTZ00073 1..89 CDD:240257 23/91 (25%)
kcnq5bXP_697081.5 None

Return to query results.
Submit another query.