DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37b and kcnv2b

DIOPT Version :9

Sequence 1:NP_611757.1 Gene:RpL37b / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001122212.1 Gene:kcnv2b / 567780 ZFINID:ZDB-GENE-060526-28 Length:527 Species:Danio rerio


Alignment Length:37 Identity:12/37 - (32%)
Similarity:15/37 - (40%) Gaps:4/37 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GRKAQGTGRMRYLKNLR----RRFRNGLREGGAAKKK 87
            |:..|....||.|:..|    .|...|||..|...|:
Zfish   350 GKVGQVLRIMRLLRIFRVLKLARHSTGLRAFGFTLKQ 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37bNP_611757.1 PTZ00073 1..89 CDD:240257 12/37 (32%)
kcnv2bNP_001122212.1 BTB 82..173 CDD:295341
BTB 84..187 CDD:197585
Ion_trans 279..484 CDD:278921 12/37 (32%)
Ion_trans_2 409..478 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.