| Sequence 1: | NP_611757.1 | Gene: | RpL37-2 / 37669 | FlyBaseID: | FBgn0034822 | Length: | 89 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001373570.1 | Gene: | kcnv2a / 567267 | ZFINID: | ZDB-GENE-091117-27 | Length: | 518 | Species: | Danio rerio |
| Alignment Length: | 33 | Identity: | 8/33 - (24%) |
|---|---|---|---|
| Similarity: | 19/33 - (57%) | Gaps: | 5/33 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 42 AKTRSFNWSRKAKGRKAQGTGRMRYLKNLRRRF 74 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RpL37-2 | NP_611757.1 | PTZ00073 | 1..89 | CDD:240257 | 8/33 (24%) |
| kcnv2a | NP_001373570.1 | BTB_POZ_KCNV2 | 84..191 | CDD:349732 | |
| Ion_trans | 243..490 | CDD:459842 | 1/2 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||