| Sequence 1: | NP_611757.1 | Gene: | RpL37-2 / 37669 | FlyBaseID: | FBgn0034822 | Length: | 89 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001153605.1 | Gene: | KCNQ5 / 56479 | HGNCID: | 6299 | Length: | 951 | Species: | Homo sapiens |
| Alignment Length: | 46 | Identity: | 15/46 - (32%) |
|---|---|---|---|
| Similarity: | 21/46 - (45%) | Gaps: | 5/46 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 30 QKSKCSQCGYPAAKTRSFNWSRKAKGRKAQGTGRMRYLKNLRRRFR 75 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RpL37-2 | NP_611757.1 | PTZ00073 | 1..89 | CDD:240257 | 15/46 (33%) |
| KCNQ5 | NP_001153605.1 | Ion_trans | 126..358 | CDD:459842 | |
| Interaction with CALM. /evidence=ECO:0000269|PubMed:29429937 | 370..378 | ||||
| KCNQ_channel | 466..653 | CDD:460954 | |||
| Interaction with CALM. /evidence=ECO:0000269|PubMed:29429937 | 540..547 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 674..697 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 895..938 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||