DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37b and kcnb2a

DIOPT Version :9

Sequence 1:NP_611757.1 Gene:RpL37b / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster
Sequence 2:XP_005163503.1 Gene:kcnb2a / 555921 ZFINID:ZDB-GENE-070912-170 Length:824 Species:Danio rerio


Alignment Length:67 Identity:16/67 - (23%)
Similarity:27/67 - (40%) Gaps:13/67 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TSFGK-RHNKTH-TICRRCGNSSYHLQKSKCSQCGYPAAKTRSFNWSRKAKGRKAQGTGRMRYLK 68
            |..|| |...|| |:...|  ..|.|..::.....:|.|.:...|:.|         ||::..::
Zfish    58 TRLGKLRDCNTHETLMEIC--DDYSLNDNEYFFDRHPGAFSSILNFYR---------TGKLHMME 111

  Fly    69 NL 70
            .:
Zfish   112 EM 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37bNP_611757.1 PTZ00073 1..89 CDD:240257 16/67 (24%)
kcnb2aXP_005163503.1 BTB 36..142 CDD:197585 16/67 (24%)
BTB_2 36..135 CDD:280393 16/67 (24%)
Ion_trans 229..427 CDD:278921
Ion_trans_2 340..421 CDD:285168
Kv2channel 473..695 CDD:281514
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.