| Sequence 1: | NP_611757.1 | Gene: | RpL37-2 / 37669 | FlyBaseID: | FBgn0034822 | Length: | 89 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_065748.1 | Gene: | KCNS2 / 3788 | HGNCID: | 6301 | Length: | 477 | Species: | Homo sapiens |
| Alignment Length: | 33 | Identity: | 14/33 - (42%) |
|---|---|---|---|
| Similarity: | 16/33 - (48%) | Gaps: | 1/33 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 55 GRKAQGTGRMRYLKNLR-RRFRNGLREGGAAKK 86 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RpL37-2 | NP_611757.1 | PTZ00073 | 1..89 | CDD:240257 | 14/33 (42%) |
| KCNS2 | NP_065748.1 | BTB_POZ_KCNS2 | 18..124 | CDD:349734 | |
| Ion_trans | 186..421 | CDD:459842 | 14/33 (42%) | ||
| Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 | 374..379 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||