powered by:
Protein Alignment RpL37b and KCNS1
DIOPT Version :9
Sequence 1: | NP_611757.1 |
Gene: | RpL37b / 37669 |
FlyBaseID: | FBgn0034822 |
Length: | 89 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016883335.1 |
Gene: | KCNS1 / 3787 |
HGNCID: | 6300 |
Length: | 527 |
Species: | Homo sapiens |
Alignment Length: | 33 |
Identity: | 12/33 - (36%) |
Similarity: | 15/33 - (45%) |
Gaps: | 1/33 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 GRKAQGTGRMRYLKNLR-RRFRNGLREGGAAKK 86
|:..|....||..:.|: .|...|||..||..|
Human 339 GKVVQVFRLMRIFRVLKLARHSTGLRSLGATLK 371
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
RpL37b | NP_611757.1 |
PTZ00073 |
1..89 |
CDD:240257 |
12/33 (36%) |
KCNS1 | XP_016883335.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2126 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.