DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37b and KCNQ1

DIOPT Version :9

Sequence 1:NP_611757.1 Gene:RpL37b / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_000209.2 Gene:KCNQ1 / 3784 HGNCID:6294 Length:676 Species:Homo sapiens


Alignment Length:47 Identity:12/47 - (25%)
Similarity:18/47 - (38%) Gaps:10/47 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PAAKTRSFNWSRKAKGRKAQGTGRMRYLKNLRRR--FRNGLREGGAA 84
            |.|:.:.:.|.|....|:...        .|.::  |...|.|||.|
Human     8 PRAERKRWGWGRLPGARRGSA--------GLAKKCPFSLELAEGGPA 46

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37bNP_611757.1 PTZ00073 1..89 CDD:240257 12/47 (26%)
KCNQ1NP_000209.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 62..84
Ion_trans 153..359 CDD:278921
Ion_trans_2 270..349 CDD:285168
Selectivity filter. /evidence=ECO:0000250 312..317
Interaction with CALM. /evidence=ECO:0000269|PubMed:25441029 370..382
KCNQ_channel <511..617 CDD:281513
Interaction with CALM, calcium-dependent. /evidence=ECO:0000269|PubMed:25441029 515..529
Interaction with KCNE1 C-terminus. /evidence=ECO:0000269|PubMed:25037568 535..572
Interaction with AKAP9. /evidence=ECO:0000269|PubMed:11799244 588..616
C-terminal assembly domain. /evidence=ECO:0000269|PubMed:10654932 589..620
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 620..676
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.