DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-2 and KCNA7

DIOPT Version :10

Sequence 1:NP_611757.1 Gene:RpL37-2 / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_114092.2 Gene:KCNA7 / 3743 HGNCID:6226 Length:456 Species:Homo sapiens


Alignment Length:38 Identity:12/38 - (31%)
Similarity:16/38 - (42%) Gaps:11/38 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RSFNWSRKAKGRKAQGTGRMRYLKNLRRRFRNGLREGG 82
            |.|..||.:||           |:.|.:..|..:||.|
Human   287 RIFKLSRHSKG-----------LQILGQTLRASMRELG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-2NP_611757.1 PTZ00073 1..89 CDD:240257 12/38 (32%)
KCNA7NP_114092.2 BTB_POZ_KCNA7 8..122 CDD:349715
Ion_trans 199..404 CDD:459842 12/38 (32%)
Selectivity filter. /evidence=ECO:0000250 358..363
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.