DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment RpL37b and KCNA4

DIOPT Version :9

Sequence 1:	NP_611757.1	Gene:	RpL37b / 37669	FlyBaseID:	FBgn0034822	Length:	89	Species:	Drosophila melanogaster
Sequence 2:	NP_002224.1	Gene:	KCNA4 / 3739	HGNCID:	6222	Length:	653	Species:	Homo sapiens

Alignment Length:	38	Identity:	12/38 - (31%)
Similarity:	15/38 - (39%)	Gaps:	11/38 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly    45 RSFNWSRKAKGRKAQGTGRMRYLKNLRRRFRNGLREGG 82
            |.|..||.:||           |:.|....|..:||.|
Human   453 RIFKLSRHSKG-----------LQILGHTLRASMRELG 479

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
RpL37b	NP_611757.1	PTZ00073	1..89	CDD:240257	12/38 (32%)
KCNA4	NP_002224.1	K_channel_TID	1..>37	CDD:400339
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	24..148
		BTB_POZ	176..303	CDD:365784
		Ion_trans	306..570	CDD:395416	12/38 (32%)
		S4-S5 linker. /evidence=ECO:0000250\|UniProtKB:P63142	462..475		5/23 (22%)
		Selectivity filter. /evidence=ECO:0000250\|UniProtKB:P63142	524..529
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	629..653
		PDZ-binding. /evidence=ECO:0000250	651..653
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2126
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900