DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37b and KCNA1

DIOPT Version :9

Sequence 1:NP_611757.1 Gene:RpL37b / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_000208.2 Gene:KCNA1 / 3736 HGNCID:6218 Length:495 Species:Homo sapiens


Alignment Length:39 Identity:11/39 - (28%)
Similarity:15/39 - (38%) Gaps:12/39 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 RMRYLKNLRRRF---RNG---------LREGGAAKKKTN 89
            ||||...||..:   ||.         .:.||..::..|
Human    69 RMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVN 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37bNP_611757.1 PTZ00073 1..89 CDD:240257 10/37 (27%)
KCNA1NP_000208.2 Tetramerization domain. /evidence=ECO:0000250|UniProtKB:P10499 1..128 11/39 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
BTB_2 39..130 CDD:308049 11/39 (28%)
Ion_trans 166..418 CDD:306908
S4-S5 linker. /evidence=ECO:0000250|UniProtKB:P63142 310..323
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 372..377
PDZ-binding. /evidence=ECO:0000250 493..495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.