| Sequence 1: | NP_611757.1 | Gene: | RpL37-2 / 37669 | FlyBaseID: | FBgn0034822 | Length: | 89 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001102384.1 | Gene: | Kcna7 / 365241 | RGDID: | 1309632 | Length: | 489 | Species: | Rattus norvegicus |
| Alignment Length: | 38 | Identity: | 12/38 - (31%) |
|---|---|---|---|
| Similarity: | 16/38 - (42%) | Gaps: | 11/38 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 45 RSFNWSRKAKGRKAQGTGRMRYLKNLRRRFRNGLREGG 82 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RpL37-2 | NP_611757.1 | PTZ00073 | 1..89 | CDD:240257 | 12/38 (32%) |
| Kcna7 | NP_001102384.1 | BTB_POZ_KCNA7 | 47..154 | CDD:349715 | |
| Ion_trans | 233..437 | CDD:459842 | 12/38 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||