DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37b and rpl3703

DIOPT Version :9

Sequence 1:NP_611757.1 Gene:RpL37b / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001018221.1 Gene:rpl3703 / 3361407 PomBaseID:SPAPB17E12.05 Length:89 Species:Schizosaccharomyces pombe


Alignment Length:81 Identity:56/81 - (69%)
Similarity:64/81 - (79%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKGTTSFGKRHNKTHTICRRCGNSSYHLQKSKCSQCGYPAAKTRSFNWSRKAKGRKAQGTGRMR 65
            |||||.|||.||||:||||||||..|:|:|||.|:.||||||||||:||..|||.|:..|||||.
pombe     1 MTKGTQSFGMRHNKSHTICRRCGKRSFHIQKSTCACCGYPAAKTRSYNWGAKAKRRRTTGTGRMS 65

  Fly    66 YLKNLRRRFRNGLREG 81
            |||.:.|.|:||.|.|
pombe    66 YLKKVHRSFKNGFRAG 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37bNP_611757.1 PTZ00073 1..89 CDD:240257 56/81 (69%)
rpl3703NP_001018221.1 PTZ00073 1..81 CDD:240257 55/79 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 100 1.000 Domainoid score I1813
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 145 1.000 Inparanoid score I1334
OMA 1 1.010 - - QHG53564
OrthoFinder 1 1.000 - - FOG0001246
OrthoInspector 1 1.000 - - mtm9284
orthoMCL 1 0.900 - - OOG6_100852
Panther 1 1.100 - - O PTHR10768
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X874
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.