| Sequence 1: | NP_611757.1 | Gene: | RpL37-2 / 37669 | FlyBaseID: | FBgn0034822 | Length: | 89 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_598004.1 | Gene: | KCNV2 / 169522 | HGNCID: | 19698 | Length: | 545 | Species: | Homo sapiens |
| Alignment Length: | 45 | Identity: | 17/45 - (37%) |
|---|---|---|---|
| Similarity: | 18/45 - (40%) | Gaps: | 12/45 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 23 GNSSYHLQKSKCSQCGYPAAKTRSFNWSRKAKGRKAQGTGRMRYL 67 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RpL37-2 | NP_611757.1 | PTZ00073 | 1..89 | CDD:240257 | 17/45 (38%) |
| KCNV2 | NP_598004.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 74..93 | ||
| BTB_POZ | 99..206 | CDD:453885 | 17/45 (38%) | ||
| Ion_trans | 266..504 | CDD:459842 | |||
| Selectivity filter. /evidence=ECO:0000250 | 457..462 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||