DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-2 and Kcns2

DIOPT Version :10

Sequence 1:NP_611757.1 Gene:RpL37-2 / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_851834.1 Gene:Kcns2 / 16539 MGIID:1197011 Length:477 Species:Mus musculus


Alignment Length:33 Identity:14/33 - (42%)
Similarity:16/33 - (48%) Gaps:1/33 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GRKAQGTGRMRYLKNLR-RRFRNGLREGGAAKK 86
            ||.||....||..:.|: .|...|||..||..|
Mouse   291 GRVAQVLRLMRIFRILKLARHSTGLRSLGATLK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-2NP_611757.1 PTZ00073 1..89 CDD:240257 14/33 (42%)
Kcns2NP_851834.1 BTB_POZ_KCNS2 18..124 CDD:349734
Ion_trans 186..421 CDD:459842 14/33 (42%)
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 374..379
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.