DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-2 and Kcnq2

DIOPT Version :10

Sequence 1:NP_611757.1 Gene:RpL37-2 / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster
Sequence 2:XP_017171224.1 Gene:Kcnq2 / 16536 MGIID:1309503 Length:937 Species:Mus musculus


Alignment Length:56 Identity:12/56 - (21%)
Similarity:27/56 - (48%) Gaps:8/56 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KGTTSFGKRHNKTHTICRRCGNSSYHLQKSKCSQCGYPAAKTRSFNWSRKAKGRKA 58
            :|..:.||...:..|: ||..::...|..|       |:...:|:::..:::.|:|
Mouse   448 RGMAAKGKGSPQAQTV-RRSPSADQSLDDS-------PSKVPKSWSFGDRSRTRQA 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-2NP_611757.1 PTZ00073 1..89 CDD:240257 12/56 (21%)
Kcnq2XP_017171224.1 Ion_trans 92..324 CDD:459842
KCNQ_channel 466..719 CDD:460954 6/37 (16%)
KCNQ2_u3 733..821 CDD:465213
KCNQC3-Ank-G_bd 833..933 CDD:463411
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.