| Sequence 1: | NP_611757.1 | Gene: | RpL37-2 / 37669 | FlyBaseID: | FBgn0034822 | Length: | 89 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006508551.2 | Gene: | Kcnq1 / 16535 | MGIID: | 108083 | Length: | 688 | Species: | Mus musculus |
| Alignment Length: | 43 | Identity: | 11/43 - (25%) |
|---|---|---|---|
| Similarity: | 17/43 - (39%) | Gaps: | 7/43 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 40 PAAKTRSFNWSRKAKGRKAQGTGRMRYLKNLRRRFRNGLREGG 82 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RpL37-2 | NP_611757.1 | PTZ00073 | 1..89 | CDD:240257 | 11/43 (26%) |
| Kcnq1 | XP_006508551.2 | Ion_trans | 149..378 | CDD:459842 | |
| KCNQ_channel | <530..636 | CDD:460954 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||