DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-2 and Kcnd1

DIOPT Version :10

Sequence 1:NP_611757.1 Gene:RpL37-2 / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_032449.1 Gene:Kcnd1 / 16506 MGIID:96671 Length:651 Species:Mus musculus


Alignment Length:49 Identity:12/49 - (24%)
Similarity:25/49 - (51%) Gaps:9/49 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 TRSFNWSRKAKGRKAQ---GTGRMRYLKN------LRRRFRNGLREGGA 83
            :|.::.:::|..|:||   ...|:|..|:      |:.:...||.:.|:
Mouse   412 SRIYHQNQRADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGS 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-2NP_611757.1 PTZ00073 1..89 CDD:240257 12/49 (24%)
Kcnd1NP_032449.1 Interaction with KCNIP1, KCNIP2, and other family members. /evidence=ECO:0000250|UniProtKB:Q63881 2..20
BTB_POZ 6..143 CDD:453885
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..164
Ion_trans 185..417 CDD:459842 1/4 (25%)
S4-S5 linker. /evidence=ECO:0000250|UniProtKB:P63142 310..323
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 372..377
DUF3399 470..550 CDD:463381
Required for dendritic targeting. /evidence=ECO:0000250|UniProtKB:Q63881 474..489
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 566..585
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 601..651
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.