| Sequence 1: | NP_611757.1 | Gene: | RpL37-2 / 37669 | FlyBaseID: | FBgn0034822 | Length: | 89 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_036008594.1 | Gene: | Kcnc3 / 16504 | MGIID: | 96669 | Length: | 807 | Species: | Mus musculus |
| Alignment Length: | 30 | Identity: | 11/30 - (36%) |
|---|---|---|---|
| Similarity: | 15/30 - (50%) | Gaps: | 1/30 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 30 QKSKCSQCGYPAAKTRSFNWSRKAKGRKAQ 59 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RpL37-2 | NP_611757.1 | PTZ00073 | 1..89 | CDD:240257 | 11/30 (37%) |
| Kcnc3 | XP_036008594.1 | BTB_KCNC1_3 | 91..204 | CDD:349721 | |
| Ion_trans | 290..551 | CDD:459842 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||