DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment RpL37b and Kcnb1

DIOPT Version :9

Sequence 1:	NP_611757.1	Gene:	RpL37b / 37669	FlyBaseID:	FBgn0034822	Length:	89	Species:	Drosophila melanogaster
Sequence 2:	NP_032446.2	Gene:	Kcnb1 / 16500	MGIID:	96666	Length:	857	Species:	Mus musculus

Alignment Length:	67	Identity:	17/67 - (25%)
Similarity:	29/67 - (43%)	Gaps:	13/67 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly     6 TSFGK-RHNKTH-TICRRCGNSSYHLQKSKCSQCGYPAAKTRSFNWSRKAKGRKAQGTGRMRYLK 68
            |..|| |...|| ::.:.|  ..|.|:.::.....:|.|.|...|:.|         |||:..::
Mouse    55 TRLGKLRDCNTHDSLLQVC--DDYSLEDNEYFFDRHPGAFTSILNFYR---------TGRLHMME 108

  Fly    69 NL 70
            .:
Mouse   109 EM 110

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
RpL37b	NP_611757.1	PTZ00073	1..89	CDD:240257	17/67 (25%)
Kcnb1	NP_032446.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..21
		BTB_POZ_KCNB2	15..141	CDD:349719	17/67 (25%)
		Self-association. /evidence=ECO:0000250\|UniProtKB:P15387	59..75		5/17 (29%)
		Ion_trans	188..424	CDD:366146
		Selectivity filter. /evidence=ECO:0000250\|UniProtKB:P63142	377..382
		Self-association. /evidence=ECO:0000250\|UniProtKB:P15387	448..481
		Kv2channel	467..678	CDD:367541
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	475..569
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	608..627
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	768..802
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	816..857
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2126
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900